SCOPe 2.08: Domain d3d5d61: 3d5d 6:9-52

Lineage for d3d5d61 (3d5d 6:9-52)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
   Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members

6. Protein Ribosomal protein L33p [144204] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
   Uniprot P35871 8-52

8. Domain d3d5d61: 3d5d 6:9-52 [157385]
   Other proteins in same PDB: d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1
   complexed with mg
   complexed with mg

Details for d3d5d61

PDB Entry: 3d5d, 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.

PDB Compounds: (6:) 50S ribosomal protein L33

SCOPe Domain Sequences for d3d5d61:

Sequence; same for both SEQRES and ATOM records:

>d3d5d61 g.41.8.6 (6:9-52) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrev

Timeline for d3d5d61:

• d3d5d61 first appeared in SCOP 1.75
  
• d3d5d61 appears in SCOPe 2.07