Lineage for d3d5d61 (3d5d 6:9-52)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2588084Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2588285Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
    Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members
  6. 2588286Protein Ribosomal protein L33p [144204] (3 species)
  7. 2588304Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
    Uniprot P35871 8-52
  8. 2588308Domain d3d5d61: 3d5d 6:9-52 [157385]
    Other proteins in same PDB: d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1
    complexed with mg
    complexed with mg

Details for d3d5d61

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (6:) 50S ribosomal protein L33

SCOPe Domain Sequences for d3d5d61:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5d61 g.41.8.6 (6:9-52) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrev

SCOPe Domain Coordinates for d3d5d61:

Click to download the PDB-style file with coordinates for d3d5d61.
(The format of our PDB-style files is described here.)

Timeline for d3d5d61: