Lineage for d3d5dv1 (3d5d V:1-101)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813866Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 813867Superfamily b.155.1: L21p-like [141091] (1 family) (S)
  5. 813868Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 813869Protein Ribosomal protein L21p [141093] (3 species)
  7. 813909Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries)
    Uniprot P60492 1-101
  8. 813913Domain d3d5dv1: 3d5d V:1-101 [157394]
    Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dy1, d3d5dz1
    automatically matched to 2HGJ U:1-101
    complexed with mg

Details for d3d5dv1

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (V:) 50S ribosomal protein L21

SCOP Domain Sequences for d3d5dv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5dv1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

SCOP Domain Coordinates for d3d5dv1:

Click to download the PDB-style file with coordinates for d3d5dv1.
(The format of our PDB-style files is described here.)

Timeline for d3d5dv1: