| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
| Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species) duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
| Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries) TM1246 |
| Domain d3d54e3: 3d54 E:167-345 [157331] Other proteins in same PDB: d3d54a1, d3d54a2, d3d54e1, d3d54e2, d3d54i1, d3d54i2 automatically matched to d1vk3a3 complexed with adp, na |
PDB Entry: 3d54 (more details), 3.5 Å
SCOPe Domain Sequences for d3d54e3:
Sequence, based on SEQRES records: (download)
>d3d54e3 d.139.1.1 (E:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi
>d3d54e3 d.139.1.1 (E:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggv
lsatselvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiar
khllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi
Timeline for d3d54e3: