Lineage for d3d54e3 (3d54 E:167-345)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978173Protein Phosphoribosylformylglycinamidine synthase II, domain 2 [419052] (1 species)
    protein duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 2978174Species Thermotoga maritima [TaxId:2336] [419543] (7 PDB entries)
    TM1246
  8. 2978182Domain d3d54e3: 3d54 E:167-345 [157331]
    Other proteins in same PDB: d3d54a1, d3d54a2, d3d54a4, d3d54e1, d3d54e2, d3d54e4, d3d54i1, d3d54i2, d3d54i4
    automatically matched to d1vk3a3
    complexed with adp, na

Details for d3d54e3

PDB Entry: 3d54 (more details), 3.5 Å

PDB Description: structure of purlqs from thermotoga maritima
PDB Compounds: (E:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d3d54e3:

Sequence, based on SEQRES records: (download)

>d3d54e3 d.139.1.1 (E:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Sequence, based on observed residues (ATOM records): (download)

>d3d54e3 d.139.1.1 (E:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggv
lsatselvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiar
khllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

SCOPe Domain Coordinates for d3d54e3:

Click to download the PDB-style file with coordinates for d3d54e3.
(The format of our PDB-style files is described here.)

Timeline for d3d54e3: