SCOPe 2.08: Domain d3d54e3: 3d54 E:167-345

Lineage for d3d54e3 (3d54 E:167-345)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domain 2 [419052] (1 species)
   protein duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:2336] [419543] (7 PDB entries)
   TM1246

8. Domain d3d54e3: 3d54 E:167-345 [157331]
   Other proteins in same PDB: d3d54a1, d3d54a2, d3d54a4, d3d54e1, d3d54e2, d3d54e4, d3d54i1, d3d54i2, d3d54i4
   automatically matched to d1vk3a3
   complexed with adp, na

Details for d3d54e3

PDB Entry: 3d54, 3.5 Å

PDB Description: structure of purlqs from thermotoga maritima

PDB Compounds: (E:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d3d54e3:

Sequence, based on SEQRES records:

>d3d54e3 d.139.1.1 (E:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Sequence, based on observed residues (ATOM records):

>d3d54e3 d.139.1.1 (E:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggv
lsatselvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiar
khllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Timeline for d3d54e3:

• d3d54e3 first appeared in SCOP 1.75
  
• d3d54e3 appears in SCOPe 2.07