Lineage for d3d54e3 (3d54 E:167-345)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873568Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 873569Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 873570Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 873585Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 873586Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
    TM1246
  8. 873601Domain d3d54e3: 3d54 E:167-345 [157331]
    Other proteins in same PDB: d3d54a1, d3d54a2, d3d54e1, d3d54e2, d3d54i1, d3d54i2
    automatically matched to d1vk3a3
    complexed with adp, na

Details for d3d54e3

PDB Entry: 3d54 (more details), 3.5 Å

PDB Description: structure of purlqs from thermotoga maritima
PDB Compounds: (E:) Phosphoribosylformylglycinamidine synthase II

SCOP Domain Sequences for d3d54e3:

Sequence, based on SEQRES records: (download)

>d3d54e3 d.139.1.1 (E:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Sequence, based on observed residues (ATOM records): (download)

>d3d54e3 d.139.1.1 (E:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggv
lsatselvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiar
khllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

SCOP Domain Coordinates for d3d54e3:

Click to download the PDB-style file with coordinates for d3d54e3.
(The format of our PDB-style files is described here.)

Timeline for d3d54e3: