SCOPe 2.07: Domain d3cvhm1: 3cvh M:182-274

Lineage for d3cvhm1 (3cvh M:182-274)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d3cvhm1: 3cvh M:182-274 [157006]
   Other proteins in same PDB: d3cvha2, d3cvhb_, d3cvhh1, d3cvhl1, d3cvhl2, d3cvhm2, d3cvhn_, d3cvhq1, d3cvhr1, d3cvhr2
   automated match to d1lk2a1

Details for d3cvhm1

PDB Entry: 3cvh, 2.9 Å

PDB Description: how tcr-like antibody recognizes mhc-bound peptide

PDB Compounds: (M:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d3cvhm1:

Sequence; same for both SEQRES and ATOM records:

>d3cvhm1 b.1.1.2 (M:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d3cvhm1:

• d3cvhm1 first appeared in SCOP 1.75
  
• d3cvhm1 appears in SCOPe 2.06
  
• d3cvhm1 appears in the current release, SCOPe 2.08