SCOPe 2.07: Domain d3cvhm2: 3cvh M:1-181

Lineage for d3cvhm2 (3cvh M:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
   Uniprot P01901 22-299

8. Domain d3cvhm2: 3cvh M:1-181 [157007]
   Other proteins in same PDB: d3cvha1, d3cvhb_, d3cvhh1, d3cvhl1, d3cvhl2, d3cvhm1, d3cvhn_, d3cvhq1, d3cvhr1, d3cvhr2
   automated match to d1lk2a2

Details for d3cvhm2

PDB Entry: 3cvh, 2.9 Å

PDB Description: how tcr-like antibody recognizes mhc-bound peptide

PDB Compounds: (M:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d3cvhm2:

Sequence; same for both SEQRES and ATOM records:

>d3cvhm2 d.19.1.1 (M:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d3cvhm2:

• d3cvhm2 first appeared in SCOP 1.75
  
• d3cvhm2 appears in SCOPe 2.06
  
• d3cvhm2 appears in the current release, SCOPe 2.08