Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d3cvhr1: 3cvh R:1-106 [199216] Other proteins in same PDB: d3cvha1, d3cvha2, d3cvhb_, d3cvhh1, d3cvhl2, d3cvhm1, d3cvhm2, d3cvhn_, d3cvhq1, d3cvhr2 automated match to d1c12a1 |
PDB Entry: 3cvh (more details), 2.9 Å
SCOPe Domain Sequences for d3cvhr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cvhr1 b.1.1.0 (R:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqvtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpdr fsgsgsrkdytliitslqtedvatyycqqywstpltfgagtklelk
Timeline for d3cvhr1: