Lineage for d3ctaa1 (3cta A:5-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693785Protein Ta1064 (RFK), N-terminal domain [158274] (1 species)
  7. 2693786Species Thermoplasma acidophilum [TaxId:2303] [158275] (1 PDB entry)
    Uniprot Q9HJA6 5-89
  8. 2693787Domain d3ctaa1: 3cta A:5-89 [156979]
    Other proteins in same PDB: d3ctaa2
    missing some secondary structures that made up less than one-third of the common domain

Details for d3ctaa1

PDB Entry: 3cta (more details), 2.2 Å

PDB Description: crystal structure of riboflavin kinase from thermoplasma acidophilum
PDB Compounds: (A:) Riboflavin kinase

SCOPe Domain Sequences for d3ctaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
dqyyraikkikeaaeasnrayltsskladmlgisqqsasriiidlekngyitrtvtkrgq
ilnitekgldvlytefadlsrilai

SCOPe Domain Coordinates for d3ctaa1:

Click to download the PDB-style file with coordinates for d3ctaa1.
(The format of our PDB-style files is described here.)

Timeline for d3ctaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ctaa2