SCOPe 2.01: Domain d3csib1: 3csi B:78-209

Lineage for d3csib1 (3csi B:78-209)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)

8. Domain d3csib1: 3csi B:78-209 [156967]
   Other proteins in same PDB: d3csia2, d3csib2, d3csic2, d3csid2
   automatically matched to d1pgta1
   complexed with ca, cl, co3, gsw, lz6, mes, so4

Details for d3csib1

PDB Entry: 3csi, 1.9 Å

PDB Description: crystal structure of the glutathione transferase pi allelic variant*c, i104v/a113v, in complex with the chlorambucil-glutathione conjugate

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3csib1:

Sequence; same for both SEQRES and ATOM records:

>d3csib1 a.45.1.1 (B:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
lygkdqqeaalvdmvndgvedlrckyvsliytnyevgkddyvkalpgqlkpfetllsqnq
ggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspe
yvnlpingngkq

Timeline for d3csib1:

• d3csib1 first appeared in SCOP 1.75
  
• d3csib1 appears in SCOPe 2.02
  
• d3csib1 appears in the current release, SCOPe 2.08