Lineage for d3csid2 (3csi D:1-77)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992593Protein Class pi GST [81358] (4 species)
  7. 992594Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries)
  8. 992652Domain d3csid2: 3csi D:1-77 [156972]
    Other proteins in same PDB: d3csia1, d3csib1, d3csic1, d3csid1
    automatically matched to d1gssa2
    complexed with ca, cl, co3, gsw, lz6, mes, so4

Details for d3csid2

PDB Entry: 3csi (more details), 1.9 Å

PDB Description: crystal structure of the glutathione transferase pi allelic variant*c, i104v/a113v, in complex with the chlorambucil-glutathione conjugate
PDB Compounds: (D:) Glutathione S-transferase P

SCOPe Domain Sequences for d3csid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3csid2 c.47.1.5 (D:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlg

SCOPe Domain Coordinates for d3csid2:

Click to download the PDB-style file with coordinates for d3csid2.
(The format of our PDB-style files is described here.)

Timeline for d3csid2: