| Class b: All beta proteins [48724] (174 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins) |
| Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species) duplication: tandem repeat of two PDZ domains |
| Species Escherichia coli [TaxId:562] [74935] (3 PDB entries) |
| Domain d3cs0a1: 3cs0 A:260-358 [156951] Other proteins in same PDB: d3cs0a3 automatically matched to d1ky9b1 |
PDB Entry: 3cs0 (more details), 3 Å
SCOPe Domain Sequences for d3cs0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cs0a1 b.36.1.4 (A:260-358) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqss
Timeline for d3cs0a1: