Lineage for d3cs0a1 (3cs0 A:260-358)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 798093Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 798099Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
    duplication: tandem repeat of two PDZ domains
  7. 798100Species Escherichia coli [TaxId:562] [74935] (3 PDB entries)
  8. 798104Domain d3cs0a1: 3cs0 A:260-358 [156951]
    Other proteins in same PDB: d3cs0a3
    automatically matched to d1ky9b1

Details for d3cs0a1

PDB Entry: 3cs0 (more details), 3 Å

PDB Description: crystal structure of degp24
PDB Compounds: (A:) Protease do

SCOP Domain Sequences for d3cs0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cs0a1 b.36.1.4 (A:260-358) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqss

SCOP Domain Coordinates for d3cs0a1:

Click to download the PDB-style file with coordinates for d3cs0a1.
(The format of our PDB-style files is described here.)

Timeline for d3cs0a1: