Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species) contains an additional FAD-binding domain of DHS-like fold |
Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries) |
Domain d3clud1: 3clu D:1-191 [156764] Other proteins in same PDB: d3cluc_, d3clud2 automated match to d1o96b1 complexed with amp, fad; mutant |
PDB Entry: 3clu (more details), 1.8 Å
SCOPe Domain Sequences for d3clud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3clud1 c.26.2.3 (D:1-191) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq srsqnkdyvev
Timeline for d3clud1: