PDB entry 3clu

View 3clu on RCSB PDB site
Description: Crystal structure of the R236K mutant from Methylophilus methylotrophus ETF
Class: electron transport
Keywords: ETF, TMADH, electron transfer, flavoprotein, dynamic interface, Electron transport, FAD, Transport
Deposited on 2008-03-20, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Electron transfer flavoprotein subunit beta
    Species: Methylophilus methylotrophus [TaxId:17]
    Gene: ETFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cluc_
  • Chain 'D':
    Compound: Electron transfer flavoprotein subunit alpha
    Species: Methylophilus methylotrophus [TaxId:17]
    Gene: ETFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53571
      • engineered (236)
    Domains in SCOPe 2.08: d3clud1, d3clud2
  • Heterogens: AMP, FAD, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cluC (C:)
    mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
    vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
    qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
    tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
    tmiegtiseqaakiiqiinefkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cluC (C:)
    mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
    vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
    qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
    tiqlginkpryaskpieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtise
    qaakiiqiinef
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cluD (D:)
    mskilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvde
    lvvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvy
    iveyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsv
    qsrsqnkdyvevgggndidittvdfimsigrgigeetnveqfreladeagatlccskpia
    dagwlpksrqvgqsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftia
    kygivadifdieeelkaqlaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cluD (D:)
    skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
    vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
    veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
    srsqnkdyvevgggndidittvdfimsigrgigeetnveqfreladeagatlccskpiad
    agwlpksrqvgqsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiak
    ygivadifdieeelkaqla