![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein) lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain |
![]() | Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) |
![]() | Species Methylophilus methylotrophus [TaxId:17] [82379] (6 PDB entries) |
![]() | Domain d3clud2: 3clu D:192-319 [156765] Other proteins in same PDB: d3cluc_, d3clud1 automated match to d1o97d2 complexed with amp, fad; mutant |
PDB Entry: 3clu (more details), 1.8 Å
SCOPe Domain Sequences for d3clud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3clud2 c.31.1.2 (D:192-319) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} gggndidittvdfimsigrgigeetnveqfreladeagatlccskpiadagwlpksrqvg qsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdie eelkaqla
Timeline for d3clud2: