SCOPe 2.08: Domain d3cluc_: 3clu C:

Lineage for d3cluc_ (3clu C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
   binds AMP

7. Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)

8. Domain d3cluc_: 3clu C: [156763]
   Other proteins in same PDB: d3clud1, d3clud2
   automated match to d1o96a_
   complexed with amp, fad; mutant

Details for d3cluc_

PDB Entry: 3clu, 1.8 Å

PDB Description: crystal structure of the r236k mutant from methylophilus methylotrophus etf

PDB Compounds: (C:) Electron transfer flavoprotein subunit beta

SCOPe Domain Sequences for d3cluc_:

Sequence, based on SEQRES records:

>d3cluc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
tmiegtiseqaakiiqiinef

Sequence, based on observed residues (ATOM records):

>d3cluc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaskpieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtise
qaakiiqiinef

Timeline for d3cluc_:

• d3cluc_ first appeared in SCOP 1.75, called d3cluc1
  
• d3cluc_ appears in SCOPe 2.07