SCOPe 2.08: Domain d3cjrb1: 3cjr B:71-137

Lineage for d3cjrb1 (3cjr B:71-137)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
   Uniprot P36238 70-139! Uniprot P36238 71-137

8. Domain d3cjrb1: 3cjr B:71-137 [156712]
   Other proteins in same PDB: d3cjra1, d3cjrb2
   protein/RNA complex; complexed with sfg

Details for d3cjrb1

PDB Entry: 3cjr, 2.05 Å

PDB Description: ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin.

PDB Compounds: (B:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cjrb1:

Sequence, based on SEQRES records:

>d3cjrb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiags
arsmgve

Sequence, based on observed residues (ATOM records):

>d3cjrb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tppasyliritweqvleiakqkmpdlnttdleaaarmiagsarsmgve

Timeline for d3cjrb1:

• d3cjrb1 first appeared in SCOP 1.75
  
• d3cjrb1 appears in SCOPe 2.07