Lineage for d3cjrb2 (3cjr B:1-70)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946686Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2946725Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
    Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70
  8. 2946728Domain d3cjrb2: 3cjr B:1-70 [156713]
    Other proteins in same PDB: d3cjra1, d3cjrb1
    protein/RNA complex; complexed with sfg

Details for d3cjrb2

PDB Entry: 3cjr (more details), 2.05 Å

PDB Description: ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin.
PDB Compounds: (B:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cjrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cjrb2 d.47.1.1 (B:1-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mkkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiy
adrsftfvtk

SCOPe Domain Coordinates for d3cjrb2:

Click to download the PDB-style file with coordinates for d3cjrb2.
(The format of our PDB-style files is described here.)

Timeline for d3cjrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cjrb1
View in 3D
Domains from other chains:
(mouse over for more information)
d3cjra1