Lineage for d3cirm1 (3cir M:443-571)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696605Protein Fumarate reductase [46981] (2 species)
  7. 2696606Species Escherichia coli [TaxId:562] [46982] (5 PDB entries)
  8. 2696614Domain d3cirm1: 3cir M:443-571 [156686]
    Other proteins in same PDB: d3cira2, d3cira3, d3cirb1, d3cirb2, d3circ1, d3cird1, d3cirm2, d3cirm3, d3cirn1, d3cirn2, d3ciro1, d3cirp1
    automatically matched to d1kf6a1
    complexed with f3s, fad, fes, sf4; mutant

Details for d3cirm1

PDB Entry: 3cir (more details), 3.65 Å

PDB Description: e. coli quinol fumarate reductase frda t234a mutation
PDB Compounds: (M:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d3cirm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cirm1 a.7.3.1 (M:443-571) Fumarate reductase {Escherichia coli [TaxId: 562]}
dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl
lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr
leysdvkit

SCOPe Domain Coordinates for d3cirm1:

Click to download the PDB-style file with coordinates for d3cirm1.
(The format of our PDB-style files is described here.)

Timeline for d3cirm1: