![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein Fumarate reductase [46550] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [46551] (6 PDB entries) |
![]() | Domain d3cirn1: 3cir N:106-243 [156689] Other proteins in same PDB: d3cira1, d3cira2, d3cira3, d3cirb2, d3circ1, d3cird1, d3cirm1, d3cirm2, d3cirm3, d3cirn2, d3ciro1, d3cirp1 automatically matched to d1kf6b1 complexed with f3s, fad, fes, sf4; mutant |
PDB Entry: 3cir (more details), 3.65 Å
SCOPe Domain Sequences for d3cirn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cirn1 a.1.2.1 (N:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d3cirn1: