Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Fumarate reductase subunit FrdC [81370] (2 species) |
Species Escherichia coli [TaxId:562] [81369] (5 PDB entries) is not known to bind heme |
Domain d3circ1: 3cir C:1-130 [156684] Other proteins in same PDB: d3cira1, d3cira2, d3cira3, d3cirb1, d3cirb2, d3cird1, d3cirm1, d3cirm2, d3cirm3, d3cirn1, d3cirn2, d3cirp1 automatically matched to d1kf6c_ complexed with f3s, fad, fes, sf4; mutant |
PDB Entry: 3cir (more details), 3.65 Å
SCOPe Domain Sequences for d3circ1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3circ1 f.21.2.2 (C:1-130) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]} ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat ivilfvalyw
Timeline for d3circ1: