Lineage for d3circ1 (3cir C:1-130)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024622Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 3024642Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 3024643Protein Fumarate reductase subunit FrdC [81370] (2 species)
  7. 3024649Species Escherichia coli [TaxId:562] [81369] (5 PDB entries)
    is not known to bind heme
  8. 3024656Domain d3circ1: 3cir C:1-130 [156684]
    Other proteins in same PDB: d3cira1, d3cira2, d3cira3, d3cirb1, d3cirb2, d3cird1, d3cirm1, d3cirm2, d3cirm3, d3cirn1, d3cirn2, d3cirp1
    automatically matched to d1kf6c_
    complexed with f3s, fad, fes, sf4; mutant

Details for d3circ1

PDB Entry: 3cir (more details), 3.65 Å

PDB Description: e. coli quinol fumarate reductase frda t234a mutation
PDB Compounds: (C:) Fumarate reductase subunit C

SCOPe Domain Sequences for d3circ1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3circ1 f.21.2.2 (C:1-130) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOPe Domain Coordinates for d3circ1:

Click to download the PDB-style file with coordinates for d3circ1.
(The format of our PDB-style files is described here.)

Timeline for d3circ1: