Class a: All alpha proteins [46456] (285 folds) |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63610] (45 PDB entries) Uniprot P09960 |
Domain d3choa1: 3cho A:461-610 [156641] Other proteins in same PDB: d3choa2, d3choa3 automated match to d3fh8a3 complexed with 4bg, act, yb, zn |
PDB Entry: 3cho (more details), 1.8 Å
SCOPe Domain Sequences for d3choa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3choa1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d3choa1: