Lineage for d3choa1 (3cho A:461-610)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745368Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 1745369Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 1745370Species Human (Homo sapiens) [TaxId:9606] [63610] (45 PDB entries)
    Uniprot P09960
  8. 1745382Domain d3choa1: 3cho A:461-610 [156641]
    Other proteins in same PDB: d3choa2, d3choa3
    automated match to d3fh8a3
    complexed with 4bg, act, yb, zn

Details for d3choa1

PDB Entry: 3cho (more details), 1.8 Å

PDB Description: crystal structure of leukotriene a4 hydrolase in complex with 2-amino- n-[4-(phenylmethoxy)phenyl]-acetamide
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3choa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3choa1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOPe Domain Coordinates for d3choa1:

Click to download the PDB-style file with coordinates for d3choa1.
(The format of our PDB-style files is described here.)

Timeline for d3choa1: