SCOPe 2.02: Domain d1liak_: 1lia K:

Lineage for d1liak_ (1lia K:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin alpha subunit [88961] (3 species)

7. Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88510] (1 PDB entry)

8. Domain d1liak_: 1lia K: [15663]
   Other proteins in same PDB: d1liab_, d1lial_
   complexed with cyc, pub

Details for d1liak_

PDB Entry: 1lia, 2.8 Å

PDB Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution

PDB Compounds: (K:) r-phycoerythrin

SCOPe Domain Sequences for d1liak_:

Sequence; same for both SEQRES and ATOM records:

>d1liak_ a.1.1.3 (K:) Phycoerythrin alpha subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]}
mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls

Timeline for d1liak_:

• d1liak_ first appeared (with stable ids) in SCOP 1.55
  
• d1liak_ appears in SCOPe 2.01
  
• d1liak_ appears in SCOPe 2.03
  
• d1liak_ appears in the current release, SCOPe 2.08