Lineage for d1liak_ (1lia K:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 737Family a.1.1.3: Phycocyanins [46532] (5 proteins)
  6. 765Protein Phycoerythrin [46540] (5 species)
  7. 774Species Red alga (Polysiphonia urceolata) [TaxId:65404] [46541] (1 PDB entry)
  8. 777Domain d1liak_: 1lia K: [15663]

Details for d1liak_

PDB Entry: 1lia (more details), 2.8 Å

PDB Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution

SCOP Domain Sequences for d1liak_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liak_ a.1.1.3 (K:) Phycoerythrin {Red alga (Polysiphonia urceolata)}
mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls

SCOP Domain Coordinates for d1liak_:

Click to download the PDB-style file with coordinates for d1liak_.
(The format of our PDB-style files is described here.)

Timeline for d1liak_: