Lineage for d1liak_ (1lia K:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.3: Phycocyanins [46532] (5 proteins) Protein Phycoerythrin [46540] (5 species) 
Species Red alga (Polysiphonia urceolata) [TaxId:65404] [46541] (1 PDB entry) 
Domain d1liak_: 1lia K: [15663]
Details for d1liak_
PDB Entry: 1lia (more details), 2.8 Å
PDB Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution
SCOP Domain Sequences for d1liak_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1liak_ a.1.1.3 (K:) Phycoerythrin {Red alga (Polysiphonia urceolata)}
mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls
SCOP Domain Coordinates for d1liak_:
Click to download the PDB-style file with coordinates for d1liak_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1liak_:
- d1liak_ appears in SCOP 1.57
- d1liak_ appears in the current release, SCOPe 2.08
View in 3D
