Lineage for d3cf5t1 (3cf5 T:2-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817766Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2817767Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 2817768Protein Ribosomal protein L27 [110326] (3 species)
  7. 2817769Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries)
    Uniprot Q9RY65 2-85
  8. 2817772Domain d3cf5t1: 3cf5 T:2-85 [156560]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR T:2-85
    protein/RNA complex; complexed with mg

Details for d3cf5t1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (T:) 50S ribosomal protein L27

SCOPe Domain Sequences for d3cf5t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5t1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

SCOPe Domain Coordinates for d3cf5t1:

Click to download the PDB-style file with coordinates for d3cf5t1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5t1: