Lineage for d3cf5f2 (3cf5 F:1-71)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946686Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2946687Species Deinococcus radiodurans [TaxId:1299] [160199] (4 PDB entries)
    Uniprot Q9RSS7 1-71
  8. 2946688Domain d3cf5f2: 3cf5 F:1-71 [156546]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJQ F:1-71
    protein/RNA complex; complexed with mg

Details for d3cf5f2

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (F:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cf5f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5f2 d.47.1.1 (F:1-71) Ribosomal protein L11, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
adrsftfitkt

SCOPe Domain Coordinates for d3cf5f2:

Click to download the PDB-style file with coordinates for d3cf5f2.
(The format of our PDB-style files is described here.)

Timeline for d3cf5f2: