Lineage for d3cf521 (3cf5 2:1-46)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2597858Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2597859Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 2597860Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 2597861Protein Ribosomal protein L34p [144323] (3 species)
  7. 2597862Species Deinococcus radiodurans [TaxId:1299] [161305] (6 PDB entries)
    Uniprot Q9RSH2 1-46
  8. 2597865Domain d3cf521: 3cf5 2:1-46 [156535]
    Other proteins in same PDB: d3cf511, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR 2:1-46
    protein/RNA complex; complexed with mg

Details for d3cf521

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: Thiopeptide antibiotic Thiostrepton bound to the large ribosomal subunit of Deinococcus radiodurans
PDB Compounds: (2:) 50S ribosomal protein L34

SCOPe Domain Sequences for d3cf521:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf521 j.118.1.1 (2:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d3cf521:

Click to download the PDB-style file with coordinates for d3cf521.
(The format of our PDB-style files is described here.)

Timeline for d3cf521: