SCOP 1.75: Domain d3cf5t1: 3cf5 T:2-85

Lineage for d3cf5t1 (3cf5 T:2-85)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
   Pfam PF01016

6. Protein Ribosomal protein L27 [110326] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159323] (11 PDB entries)
   Uniprot Q9RY65 2-85

8. Domain d3cf5t1: 3cf5 T:2-85 [156560]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR T:2-85
   complexed with mg, txx

Details for d3cf5t1

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (T:) 50S ribosomal protein L27

SCOP Domain Sequences for d3cf5t1:

Sequence; same for both SEQRES and ATOM records:

>d3cf5t1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

Timeline for d3cf5t1:

• d3cf5t1 is new in SCOP 1.75
  
• d3cf5t1 appears in SCOPe 2.01
  
• d3cf5t1 appears in the current release, SCOPe 2.08