Lineage for d1b33i_ (1b33 I:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1475382Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1475395Protein Allophycocyanin beta subunit [88957] (3 species)
  7. 1475396Species Mastigocladus laminosus [TaxId:83541] [88959] (1 PDB entry)
  8. 1475400Domain d1b33i_: 1b33 I: [15656]
    Other proteins in same PDB: d1b33a_, d1b33c_, d1b33e_, d1b33h_, d1b33j_, d1b33l_, d1b33n_, d1b33o_
    complexed with bla, bo4, cyc

Details for d1b33i_

PDB Entry: 1b33 (more details), 2.3 Å

PDB Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
PDB Compounds: (I:) allophycocyanin, beta chain

SCOPe Domain Sequences for d1b33i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b33i_ a.1.1.3 (I:) Allophycocyanin beta subunit {Mastigocladus laminosus [TaxId: 83541]}
mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls

SCOPe Domain Coordinates for d1b33i_:

Click to download the PDB-style file with coordinates for d1b33i_.
(The format of our PDB-style files is described here.)

Timeline for d1b33i_: