Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Allophycocyanin beta subunit [88957] (3 species) |
Species Mastigocladus laminosus [TaxId:83541] [88959] (1 PDB entry) |
Domain d1b33i_: 1b33 I: [15656] Other proteins in same PDB: d1b33a_, d1b33c_, d1b33e_, d1b33h_, d1b33j_, d1b33l_, d1b33n_, d1b33o_ complexed with bla, bo4, cyc |
PDB Entry: 1b33 (more details), 2.3 Å
SCOPe Domain Sequences for d1b33i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b33i_ a.1.1.3 (I:) Allophycocyanin beta subunit {Mastigocladus laminosus [TaxId: 83541]} mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls
Timeline for d1b33i_: