Lineage for d3cf511 (3cf5 1:2-54)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066475Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1066676Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
    Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members
  6. 1066677Protein Ribosomal protein L33p [144204] (3 species)
  7. 1066678Species Deinococcus radiodurans [TaxId:1299] [161179] (6 PDB entries)
    Uniprot Q9RSS4 2-54
  8. 1066680Domain d3cf511: 3cf5 1:2-54 [156534]
    Other proteins in same PDB: d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR 1:2-54
    protein/RNA complex; complexed with mg

Details for d3cf511

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (1:) 50S ribosomal protein L33

SCOPe Domain Sequences for d3cf511:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf511 g.41.8.6 (1:2-54) Ribosomal protein L33p {Deinococcus radiodurans [TaxId: 1299]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

SCOPe Domain Coordinates for d3cf511:

Click to download the PDB-style file with coordinates for d3cf511.
(The format of our PDB-style files is described here.)

Timeline for d3cf511: