Lineage for d3cf5h1 (3cf5 H:1-134)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949112Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 949113Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 949114Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 949115Protein Ribosomal protein L14 [50195] (5 species)
  7. 949122Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
    Uniprot Q9RXJ2 1-134
  8. 949124Domain d3cf5h1: 3cf5 H:1-134 [156548]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR H:1-134
    protein/RNA complex; complexed with mg

Details for d3cf5h1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (H:) 50S ribosomal protein L14

SCOPe Domain Sequences for d3cf5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5h1 b.39.1.1 (H:1-134) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap
rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd
rrfmkivslapevl

SCOPe Domain Coordinates for d3cf5h1:

Click to download the PDB-style file with coordinates for d3cf5h1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5h1: