![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
![]() | Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() automatically mapped to Pfam PF01280 |
![]() | Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
![]() | Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
![]() | Domain d3ccup1: 3ccu P:1-143 [156441] Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccuq1, d3ccur1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuy1, d3ccuz1 automatically matched to d1s72p_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccu (more details), 2.8 Å
SCOPe Domain Sequences for d3ccup1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccup1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d3ccup1: