![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
![]() | Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) ![]() some topological similarity to prokaryotic ribosomal protein L17 |
![]() | Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
![]() | Protein Ribosomal protein L22 [54845] (5 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries) Uniprot P10970 |
![]() | Domain d3ccur1: 3ccu R:1-150 [156443] Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccup1, d3ccuq1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuy1, d3ccuz1 automatically matched to d1ffko_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccu (more details), 2.8 Å
SCOPe Domain Sequences for d3ccur1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccur1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]} gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg eqqgrkpramgrasawnspqvdvelileep
Timeline for d3ccur1: