Lineage for d3ccsp1 (3ccs P:1-143)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333978Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 2333979Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 2333980Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 2333981Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 2333982Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 2334035Domain d3ccsp1: 3ccs P:1-143 [156417]
    Other proteins in same PDB: d3ccs11, d3ccs21, d3ccs31, d3ccsb1, d3ccsd1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsj1, d3ccsk1, d3ccsl1, d3ccsn1, d3ccso1, d3ccsq1, d3ccsr1, d3ccss1, d3ccst1, d3ccsu1, d3ccsv1, d3ccsw1, d3ccsx1, d3ccsy1, d3ccsz1
    automatically matched to d1s72p_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccsp1

PDB Entry: 3ccs (more details), 2.95 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3ccsp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccsp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d3ccsp1:

Click to download the PDB-style file with coordinates for d3ccsp1.
(The format of our PDB-style files is described here.)

Timeline for d3ccsp1: