Lineage for d3ccsy1 (3ccs Y:95-236)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459800Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2459860Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2459861Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2459862Protein Ribosomal protein L32e [52044] (1 species)
  7. 2459863Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2459916Domain d3ccsy1: 3ccs Y:95-236 [156426]
    Other proteins in same PDB: d3ccs11, d3ccs21, d3ccs31, d3ccsb1, d3ccsd1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsj1, d3ccsk1, d3ccsl1, d3ccsn1, d3ccso1, d3ccsp1, d3ccsq1, d3ccsr1, d3ccss1, d3ccst1, d3ccsu1, d3ccsv1, d3ccsw1, d3ccsx1, d3ccsz1
    automatically matched to d1jj2x_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccsy1

PDB Entry: 3ccs (more details), 2.95 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3ccsy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccsy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d3ccsy1:

Click to download the PDB-style file with coordinates for d3ccsy1.
(The format of our PDB-style files is described here.)

Timeline for d3ccsy1: