![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (3 proteins) |
![]() | Protein Prokaryotic (50S subunit) [58125] (3 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3ccsv1: 3ccs V:1-65 [156423] Other proteins in same PDB: d3ccs21, d3ccsb1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsp1, d3ccsr1, d3ccss1, d3ccsy1, d3ccsz1 automatically matched to d1w2bu_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccs (more details), 2.95 Å
SCOPe Domain Sequences for d3ccsv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccsv1 i.1.1.2 (V:1-65) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d3ccsv1: