Lineage for d3ccjt1 (3ccj T:1-119)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897399Domain d3ccjt1: 3ccj T:1-119 [156301]
    Other proteins in same PDB: d3ccj21, d3ccjb1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjp1, d3ccjr1, d3ccjs1, d3ccjy1, d3ccjz1
    automatically matched to d1w2bs_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccjt1

PDB Entry: 3ccj (more details), 2.7 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOP Domain Sequences for d3ccjt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccjt1 i.1.1.2 (T:1-119) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d3ccjt1:

Click to download the PDB-style file with coordinates for d3ccjt1.
(The format of our PDB-style files is described here.)

Timeline for d3ccjt1: