Lineage for d3ccjp1 (3ccj P:1-143)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773657Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 773658Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 773659Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 773660Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 773661Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 773701Domain d3ccjp1: 3ccj P:1-143 [156297]
    Other proteins in same PDB: d3ccj11, d3ccj21, d3ccj31, d3ccjb1, d3ccjd1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjj1, d3ccjk1, d3ccjl1, d3ccjn1, d3ccjo1, d3ccjq1, d3ccjr1, d3ccjs1, d3ccjt1, d3ccju1, d3ccjv1, d3ccjw1, d3ccjx1, d3ccjy1, d3ccjz1
    automatically matched to d1s72p_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccjp1

PDB Entry: 3ccj (more details), 2.7 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOP Domain Sequences for d3ccjp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccjp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d3ccjp1:

Click to download the PDB-style file with coordinates for d3ccjp1.
(The format of our PDB-style files is described here.)

Timeline for d3ccjp1: