Lineage for d3ccj21 (3ccj 2:1-49)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778338Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 778339Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 778340Protein Ribosomal protein L39e [48664] (1 species)
  7. 778341Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 778381Domain d3ccj21: 3ccj 2:1-49 [156285]
    Other proteins in same PDB: d3ccj11, d3ccj31, d3ccjb1, d3ccjd1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjj1, d3ccjk1, d3ccjl1, d3ccjn1, d3ccjo1, d3ccjp1, d3ccjq1, d3ccjr1, d3ccjs1, d3ccjt1, d3ccju1, d3ccjv1, d3ccjw1, d3ccjx1, d3ccjy1, d3ccjz1
    automatically matched to 1VQ4 2:1-49
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccj21

PDB Entry: 3ccj (more details), 2.7 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOP Domain Sequences for d3ccj21:

Sequence, based on SEQRES records: (download)

>d3ccj21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3ccj21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOP Domain Coordinates for d3ccj21:

Click to download the PDB-style file with coordinates for d3ccj21.
(The format of our PDB-style files is described here.)

Timeline for d3ccj21: