Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3ccju1: 3ccj U:4-56 [156302] Other proteins in same PDB: d3ccj21, d3ccjb1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjp1, d3ccjr1, d3ccjs1, d3ccjy1, d3ccjz1 automatically matched to d1w2bt_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant |
PDB Entry: 3ccj (more details), 2.7 Å
SCOP Domain Sequences for d3ccju1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccju1 i.1.1.2 (U:4-56) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
Timeline for d3ccju1: