SCOPe 2.08: Domain d2vhba_: 2vhb A:

Lineage for d2vhba_ (2vhb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Bacterial dimeric hemoglobin [46526] (1 species)

7. Species Vitreoscilla stercoraria [TaxId:61] [46527] (7 PDB entries)

8. Domain d2vhba_: 2vhb A: [15629]
   complexed with azi, hem

Details for d2vhba_

PDB Entry: 2vhb, 1.76 Å

PDB Description: azide adduct of the bacterial hemoglobin from vitreoscilla stercoraria

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d2vhba_:

Sequence, based on SEQRES records:

>d2vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqave

Sequence, based on observed residues (ATOM records):

>d2vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfeqpkalamtvlaaaqnie
nlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvi
advfiqveadlyaqave

Timeline for d2vhba_:

• d2vhba_ first appeared (with stable ids) in SCOP 1.55
  
• d2vhba_ appears in SCOPe 2.07