Lineage for d2vhbb_ (2vhb B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299436Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 2299437Species Vitreoscilla stercoraria [TaxId:61] [46527] (7 PDB entries)
  8. 2299443Domain d2vhbb_: 2vhb B: [15630]
    complexed with azi, hem

Details for d2vhbb_

PDB Entry: 2vhb (more details), 1.76 Å

PDB Description: azide adduct of the bacterial hemoglobin from vitreoscilla stercoraria
PDB Compounds: (B:) hemoglobin

SCOPe Domain Sequences for d2vhbb_:

Sequence, based on SEQRES records: (download)

>d2vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records): (download)

>d2vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfleqpkalamtvlaaaqni
enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
iadvfiqveadlyaqav

SCOPe Domain Coordinates for d2vhbb_:

Click to download the PDB-style file with coordinates for d2vhbb_.
(The format of our PDB-style files is described here.)

Timeline for d2vhbb_: