SCOPe 2.02: Domain d3c8hd2: 3c8h D:151-396

Lineage for d3c8hd2 (3c8h D:151-396)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Enterochelin esterase, catalytic domain [142699] (2 species)

7. Species Shigella flexneri 2a str. 2457T [TaxId:198215] [159733] (3 PDB entries)

8. Domain d3c8hd2: 3c8h D:151-396 [156044]
   Other proteins in same PDB: d3c8ha1, d3c8hb1, d3c8hc1, d3c8hd1
   automatically matched to d2b20a2

Details for d3c8hd2

PDB Entry: 3c8h, 2.48 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of 2,3-Di-hydroxy-N-benzoyl-serine

PDB Compounds: (D:) enterochelin esterase

SCOPe Domain Sequences for d3c8hd2:

Sequence, based on SEQRES records:

>d3c8hd2 c.69.1.2 (D:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagev
saeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglid
lwqplf

Sequence, based on observed residues (ATOM records):

>d3c8hd2 c.69.1.2 (D:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdverplavlldgefwaqsmpvwp
vltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdrad
rtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsae
glrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlwq
plf

Timeline for d3c8hd2:

• d3c8hd2 first appeared in SCOP 1.75
  
• d3c8hd2 appears in SCOPe 2.01
  
• d3c8hd2 appears in SCOPe 2.03
  
• d3c8hd2 appears in the current release, SCOPe 2.08