Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein) PfamB PB013071 |
Protein Enterochelin esterase [141031] (1 species) |
Species Shigella flexneri 2a str. 2457T [TaxId:198215] [141032] (4 PDB entries) Uniprot Q83SB9 3-150 |
Domain d3c8hb1: 3c8h B:6-150 [156039] Other proteins in same PDB: d3c8ha2, d3c8hb2, d3c8hc2, d3c8hd2 automatically matched to d2b20a1 |
PDB Entry: 3c8h (more details), 2.48 Å
SCOPe Domain Sequences for d3c8hb1:
Sequence, based on SEQRES records: (download)
>d3c8hb1 b.1.18.20 (B:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} vgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqp qsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaia dplnpqswkgglghavsalempqap
>d3c8hb1 b.1.18.20 (B:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} vgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdpqsmqri agtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiadplnpq swkgglghavsalempqap
Timeline for d3c8hb1: