SCOPe 2.08: Domain d3c6la1: 3c6l A:7-109

Lineage for d3c6la1 (3c6l A:7-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)

8. Domain d3c6la1: 3c6l A:7-109 [155977]
   Other proteins in same PDB: d3c6la2, d3c6lc1, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le2, d3c6lg1, d3c6lg2, d3c6lh1, d3c6lh2
   automatically matched to d1lila1
   complexed with ca

Details for d3c6la1

PDB Entry: 3c6l, 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20

PDB Compounds: (A:) TCR 2W20 alpha chain

SCOPe Domain Sequences for d3c6la1:

Sequence; same for both SEQRES and ATOM records:

>d3c6la1 b.1.1.1 (A:7-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
pqsltvwegetailncsyedstfdyfpwyhqfpgespalliairpvsnkkedgrftiffn
krekkfslhiadsqpgdsatyfcaasdnriffgdgtqlvv

Timeline for d3c6la1:

• d3c6la1 first appeared in SCOP 1.75
  
• d3c6la1 appears in SCOPe 2.07