Lineage for d3c6lc1 (3c6l C:83-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747416Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2747460Domain d3c6lc1: 3c6l C:83-182 [155979]
    Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le1, d3c6le2, d3c6lg2, d3c6lh1, d3c6lh2
    automatically matched to d1k2da1
    complexed with ca

Details for d3c6lc1

PDB Entry: 3c6l (more details), 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d3c6lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c6lc1 b.1.1.2 (C:83-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOPe Domain Coordinates for d3c6lc1:

Click to download the PDB-style file with coordinates for d3c6lc1.
(The format of our PDB-style files is described here.)

Timeline for d3c6lc1: