![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d3c6lc1: 3c6l C:83-182 [155979] Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le1, d3c6le2, d3c6lg2, d3c6lh1, d3c6lh2 automatically matched to d1k2da1 complexed with ca |
PDB Entry: 3c6l (more details), 3.4 Å
SCOPe Domain Sequences for d3c6lc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c6lc1 b.1.1.2 (C:83-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr dysfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d3c6lc1: