Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries) |
Domain d3c6lc2: 3c6l C:1-82 [155980] Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc1, d3c6ld1, d3c6ld2, d3c6le1, d3c6le2, d3c6lg1, d3c6lh1, d3c6lh2 automatically matched to d1k2da2 complexed with ca fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3c6l (more details), 3.4 Å
SCOPe Domain Sequences for d3c6lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c6lc2 d.19.1.1 (C:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg lqniavvkhnlgvltkrsnstp
Timeline for d3c6lc2: